PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_10429939g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 272aa    MW: 31622.8 Da    PI: 6.9599
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_10429939g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.41.4e-121563148
                      TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                      r +WTt Ed +l d+++ +G +  W++   + g++R++k+c++rw +yl
  MA_10429939g0010 15 RVAWTTKEDMILRDYINIHGLEgGWRSLRDKTGLNRSGKSCRLRWMNYL 63
                      679*****************8899***********************97 PP

2Myb_DNA-binding47.73.7e-1569114148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+ +t+E+el+++++++lG++ W++Ia +++ g t +++k++w+++l
  MA_10429939g0010  69 RGNISTDEEELIIRLHRLLGNR-WSLIAGRLP-GQTNNEIKNYWNTHL 114
                       7899******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.0411063IPR017930Myb domain
SuperFamilySSF466893.71E-2413110IPR009057Homeodomain-like
SMARTSM007171.9E-91465IPR001005SANT/Myb domain
PfamPF002499.9E-111563IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-191770IPR009057Homeodomain-like
CDDcd001671.66E-61763No hitNo description
PROSITE profilePS5129423.47964118IPR017930Myb domain
SMARTSM007172.7E-1368116IPR001005SANT/Myb domain
PfamPF002496.7E-1369114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2371118IPR009057Homeodomain-like
CDDcd001671.62E-873114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MGRSPRRSRD EGLNRVAWTT KEDMILRDYI NIHGLEGGWR SLRDKTGLNR SGKSCRLRWM  60
NYLRPNIKRG NISTDEEELI IRLHRLLGNR WSLIAGRLPG QTNNEIKNYW NTHLRKKIGT  120
LIKHDLNEAK MTEEDINIST GLDLVGANQI VVNIENNITD AQSFDEQLKT LLEEDSTMEK  180
CSRHHNNMTS LILEDEELFF KHNGITSEGV LVMDVKCDIK DLLNRDERQV RREERLESLL  240
RALQLNTPNI GILDKDIAQD QQKERMPDHS FG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-191311825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1189420.0BT118942.1 Picea glauca clone GQ04012_C23 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008228205.17e-57PREDICTED: transcription factor TT2-like
TrEMBLB8LMJ67e-60B8LMJ6_PICSI; Putative uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.12e-42myb domain protein 6